SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003979 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003979
Domain Number 1 Region: 207-548
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.77e-38
Family Tyrosine-dependent oxidoreductases 0.0035
Further Details:      
 
Domain Number 2 Region: 820-934
Classification Level Classification E-value
Superfamily POZ domain 1.08e-24
Family BTB/POZ domain 0.028
Further Details:      
 
Domain Number 3 Region: 610-811,886-917
Classification Level Classification E-value
Superfamily ARM repeat 1.88e-17
Family Armadillo repeat 0.027
Further Details:      
 
Domain Number 4 Region: 560-620
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000672
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003979
Sequence length 1130
Comment protein Name="PYU1_T003979" Note="Similar to F: Dihydroflavonol-4-reductase (Callistephus chinensis)" AED:0.0270416222220125 QI:0|1|0.8|1|1|1|10|0|1130
Sequence
MLFGAQYDDDSSDRVDGPSPTQPRKKKTSRSAARSGAVTTNINNNTPGRTSSSRRTSERR
STATTNGNHVASPSSSSYSYQSTSSSSLTSLASSFNNENNNYNYNYNLNSISKAYQYAAG
NATYDGAASSTMGRTSISNTPVKTTTNGNAKRRNGDPVKRYSKLFGVLDEIAPAPRPIDK
TVMYPSVWKELRFRKKMIQLASSLSVKPICVTGVDGFLASWIVCELLKRGYRVRGTVQNR
KDDVSGIMALPAAKNNFTIVETSLLTPEACDMAVQGCDFVIHTGTPSSCSVRDPLSEQQE
PGVHSIGSRMHCIIPMMTNFIQACARARVKRVVLTSSVAAMADSVSPHSIVNDACWNISS
SLERNPHFLSLKLAEEAAWQLVDQLPRDRRIDLVTINPGTLFGPALSKGKLAPGNQVIYD
LITGQYSALVDLNWSMVDVRDCALAHIAALENSEARGRYICVNKTVWMKEIVDILSHNGY
SGRDLPWRVGLPNWVARLPAYSAQLGQVGAALYAYEPNMARPSPYLSDKINDVLNVQFRR
PRDSIIESANDLLKWGLIKPWAEDHEAIDCACCKNVFTFYRRKHHCRECGEIICHECSMS
RAVVEGSEGRARLCDKCVKNSIPELVDMLKADDPDKKRKAVVALESLLENEVNHDYVTRF
GGIVLLLEAMHNPDDIISAHAAGALCALSSSVSSTLHMVLEGAVLQMLEVEEASRTWGIC
LQALRNIWKQINRADFRRMLHAVARVSADANIGELRGNILLTFVHMMDSNEVPNLLSEGL
FSVLYHMLQSSDEFHRCAAAHAIKHLVPQGYDPDLTINVPPYLVDDHEELFLNSSLSDLQ
FLVKGHIAPINAHKVVLFFRNSYFKNMVRFGSATSQTAMIEVNNCSYEVFSILLRFLYTG
KVDITPDIAVELLQAASFYCVLELQKRAEEFLSHEIRVDNVVNLLSVSEECNAEDLKKNC
IPYLMRHIHEVVRLPSFTEHRVQASEEVLKALASVLGPEWEASYLKFRESIEPPQEKKKF
HDFPPQRKESISFRDPTPMSLPREAEIPEYLLNHEFLLSPIPPPSNNGYQPSFATVDSPL
LYSGMDNDEQQQPQQDELSYAKTFSNTEMLFNRPYGFSEDLSEGISEGVC
Download sequence
Identical sequences K3WG88
PYU1_T003979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]