SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004015 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004015
Domain Number 1 Region: 4-270
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 8.16e-58
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 280-371
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 4.71e-17
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004015
Sequence length 423
Comment protein Name="PYU1_T004015" Note="Similar to TP_0104: Probable 5'-nucleotidase (Treponema pallidum)" AED:0.307901934358649 QI:0|-1|0|1|-1|1|1|0|423
Sequence
MAYSDVYEMLQDDVSGLKLGGPSRVVPLVKDMRCKNPNSLVLFAGDTMSPSLWSSQFRGM
QMVDAHNAIGIDFASLGNHEFDFGIEGFYNVSKASNFPWLNANCYEVGTKTLLRGTMPNA
VKTFDHRKFGKVKIGFFGVMYDMKDSSKGLYWTDPIEAAKQQVKLLKNQSVDLIIALTHQ
TLADDNRLSKEVTGVNLIYGGHDHTSMLQSNYGTPYLKPDFDFRSIWLSRIEYFAASGSL
TTTTRMTHRAIPIVEEMPSDPDLDKVIADYTIKIGILHARVIGTLCEPLDVTNKLVRAGD
TPVGAIFSDAGLSFYGPGSADASVTNGGSIRTDKVYPAGNLSIGQVIAWSPFGNTLMIIE
TDGASLKKYITKEMRASCGEVVSRVFVNEAKVRRMDTALETYIKSFPNANVCAKAEERSI
LTF
Download sequence
Identical sequences K3WGC4
PYU1_T004015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]