SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004016 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004016
Domain Number 1 Region: 32-306
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.09e-57
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 313-474
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.79e-27
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004016
Sequence length 525
Comment protein Name="PYU1_T004016" Note="Similar to Nt5e: 5'-nucleotidase (Mus musculus)" AED:1 QI:0|-1|0|0|-1|1|1|0|525
Sequence
MKIFRSLALAVFAVVLGAQSSSALRNVTAVVDVIAYNDVYEMLQDEVNGLKVGGPSRVIP
IVKEMRAKNPNSLVIFAGDTMSPSLWSSQFHGMQMVDAHNAIGVDFASLGNHEFDFGIEG
FLNVSAATNFPWLNANCYEIGTGSLLRNTKARAIKTFKDPTFGSIKIGFFGVMYDMKDSS
KGLYWTDPIEAAKKQVAFLKTQSVDFIIALTHQDLADDNRFSKGVTGVNLIYAGHDHSSM
LQTNFGAPYLKADFDFRSIWSSRLEFFTASGSLAATTRMTHKAIPIIEEMPSDPALDKVI
ADYATQIGLLHARVIGTLCETLDVTNKLVRAADSAIGAIFADASLNFYGQGSADVALMNG
GGIRSDTTYPAGNLTIGQVISWSPFGNTLMVIETDGASMKKYIKKETLASCGANFINLNG
YYVQPGGIKYTFKCTGSGAGDITSIEWFKHPTRTGPVLDTDVFKLAISNYLYNTEYLLTP
GAVVSKVVVSEAEASRIDTALEVFVKSLPNANLCYKADGRSLVSF
Download sequence
Identical sequences K3WGC5
PYU1_T004016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]