SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004022 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004022
Domain Number 1 Region: 418-579
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 8.35e-22
Family mRNA capping enzyme 0.0019
Further Details:      
 
Domain Number 2 Region: 68-259
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.000000000546
Family Dual specificity phosphatase-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004022
Sequence length 622
Comment protein Name="PYU1_T004022" Note="Similar to RNGTT: mRNA-capping enzyme (Homo sapiens)" AED:0.0882307177643965 QI:0|0.88|0.8|0.9|1|1|10|61|622
Sequence
MAGDDGDTKVTVVTTDDAEARAAIAAKLKLAAKIPASKLLNGSSSSQTKRAGRGGSNGGG
GRKLLHKSPEQWSAFEQTPVTMSIVPSARILPIRCPLSSLYEIHFSNKQKVFTPSTLMEK
LIADSRSGTVVNVGTVIDATGGSAFLYDPKEWDDWEVEYVKLKVNIPEDILEQDRQANDD
AMLAAFFSAVEKHKSGDNKDMDIAVYGATGYSFVGFLTVSYLIEYCGLSLDSAVSEFAAS
SPPGIYSPYYLERLYRKYFSTLASSSTRLSCPPAPKWDPAAGKKGNTDIGPELLTEQDQT
NKFVRKSLPARPQATTPIGNGKPAYTAPVPVYKPPLYIPPDRADMNNRPTKRRKIRSWMD
DVPPLAFGEPVDPSSEEHEVAMKALEKLTGHEGFPGCEAIPLTATHVAERAYSQKGCLTK
NYLVTWRARGRRCLLFVSKDATYVVSRDMTFTKVNMKFPRKRAPAECQVNTLIDGIIVED
QDQGTKVSRYLAFDIIFIDGTPIWQKKLEKRLQCLQNEVILARKNDQTFDYAKEPFRVRM
KDHFRLVKTEYLLQKFVKSVTHDVDGVIYTPTEALYNLGGFESDEPIFKFVSSEAGGGIP
GLDGSITERRLLSYIQSIPQNK
Download sequence
Identical sequences K3WGD1
PYU1_T004022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]