SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004050 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004050
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000000249
Family Rhomboid-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004050
Sequence length 60
Comment protein Name="PYU1_T004050" Note="Similar to At3g17611: Uncharacterized protein At3g17611 (Arabidopsis thaliana)" AED:0.133333333333333 QI:1|0|0|0.5|1|0.5|2|-1|60
Sequence
IGFSGVLFALKVLLNHNSPTFSSVYGFQVPTKYAAWLELVVIHYLVPHSSFMGHMCGILA
Download sequence
Identical sequences PYU1_T004050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]