SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004056 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T004056
Domain Number - Region: 821-876
Classification Level Classification E-value
Superfamily F-box domain 0.0621
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004056
Sequence length 1245
Comment protein Name="PYU1_T004056" Note="Protein of unknown function" AED:0.424291064740503 QI:0|0|0|0.33|1|1|3|0|1245
Sequence
MTEQDSQEIRLCALVLSVVAFFLFIAAEIVHDNAYACRAVILLVATGALGFAWIGPLTLL
AGTLRSKKFQWWQPFQGGVEFVWMQAFGWCLHTFVLTASVVVLANSQLPKWFEGQYLFLG
VTGFIAQILLNLSIGCFREVDTEQPAFQLPLNAKTVVSLLVSGSGLLLFVFYDLFSHLGQ
SPVVIAVGCVEFIASALVIHVFYGCADIPGYRIWQPFEGERTFLLLQYFGWQLFAFTIGG
AMNLFCSANDMSGYGSSKGTATAIGTMGMTSQILLLVSLQYFDKGSASQTSKASPSDHAA
QPTGLLPLNHITSKTKTKLPAEIYVTSMLCSGALAVGLLSYTSRAKIGVAPEQIEQFFLA
HEKVGWIISLCSLAIAAPISNMGGVRSKPQYSWWQPFQGGTKFVFLQTLGWLWYGFYLAL
SIVLCMNSPKFGELIGCFVLLVGAGSAGAIALSLSYFEPQDLKTTKARDSNQVLYWCDAT
KGEVAMVVLLSMSSMLFHLLVDFFQDLIYWSSVFFRFRGIQLLTGLLYFVSQMLLLYSLP
FFEVTKSHVKAIVRGKPRLQNEIRRKAEDLVNQYFVGRLLGFSACCVFVLVDFTMLHVGP
SIPMFPATICAVLGLFSSIPLTYKFATSTYGPKAKSISGSIVFIVLGCALWSFTLLLGAL
FSYQLWSTQAIDRSMPRSENAPTQFMGTFTGSVGFMAQLLFFQASESSLLKQGPKGEVSS
EENLVMVMTKLKKNLKCASIWVYSAITLVSGLVYAHTKSVIPKHLATTQVLGLVFCCVVV
IWSAWCIQQQIISSGGGIVQYSKCFAVSQDCESDIVTKQIPILDVGLDCYAQLVAFLTVS
EIVGMSTTCKTAHAFHTDALWRQIFARRYGGSHMDRTLLKLKTADTRGYEDTNENAITVR
TKPFAATSLHRMETTVLNMVCGLEFPTIQPAPPKSAIISMQSKWKTFCIGREKHFRFDQC
KVCKTVEAFSSAPQLWEMQENCARRSPSTWVNLCHCVNPVTLRHEKAHRGCLEILRKQYH
ATEPHPRPQRMEIEYCASCELGITEVGRLPNTIRELLQVTWEHFCAPEHEFGGGFFSFVP
CSASIFIFALKSVGWGSCSMYIWLVTVVALCFVVNSPRFDRALAQIGGEESPSYQAYQRT
YYALVLSSIAHLAWCCPTVNQSDAMRNPSLTQTLILLGFRVNFGIFLILALTCFFVFWRT
QYRISTVRGVDEASLSESANAQSIAPSADKSCVLCLLKLCSEDRG
Download sequence
Identical sequences K3WGG5
PYU1_T004056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]