SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004143 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004143
Domain Number 1 Region: 29-81
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000718
Family Myb/SANT domain 0.036
Further Details:      
 
Weak hits

Sequence:  PYU1_T004143
Domain Number - Region: 89-134
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.054
Family Pseudouridine synthase RsuA/RluD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004143
Sequence length 195
Comment protein Name="PYU1_T004143" Note="Similar to mybJ: Myb-like protein J (Dictyostelium discoideum)" AED:0.0867346938775511 QI:0|-1|0|1|-1|1|1|0|195
Sequence
MSQPSTPLSSTPSTPTGSNNDFIPMGSITRGLWSEQEHEQFLEAMKLFPKGPWRSIAAFI
GTRSIKQVQTHAQKYQQKINRRQRGLRKQKKKFVRPEHRVDVHASGCIIRTKNTQDSPRS
PSALLRTQSRKSYTRMLAETSTTEDEDFSDEEIDLAKLLEGLEPFPFTHVPCEEIFALDD
RYTQDLLESVDLLQL
Download sequence
Identical sequences K3WGQ2
PYU1_T004143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]