SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004144 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004144
Domain Number 1 Region: 31-83
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000419
Family Myb/SANT domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004144
Sequence length 201
Comment protein Name="PYU1_T004144" Note="Similar to mybH: Myb-like protein H (Dictyostelium discoideum)" AED:0.0504050405040504 QI:0|-1|0|1|-1|1|1|0|201
Sequence
MATMASTLGMPGANGPSSMAASASAMALAHSTRGIWSHEEHDRFLRAMKLYPKGPWKTIA
DHIATRSVRQVQTHAQKYQEKVSRRLRGLRKSKKKLVRPEHRIDDDTMELCKLVDSAAEK
LAATSSPRCKLEVVEGKDGVSAGAAAADSSKSTSVLDLDDSLGKDDLQPLPFVDFDNIEL
DPVHLPTVSESLDFLIEYLSV
Download sequence
Identical sequences K3WGQ3
PYU1_T004144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]