SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004147 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004147
Domain Number 1 Region: 46-155
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 6.67e-33
Family Tubulin, GTPase domain 0.00029
Further Details:      
 
Domain Number 2 Region: 220-267,301-427
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 1.01e-18
Family Tubulin, C-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004147
Sequence length 429
Comment protein Name="PYU1_T004147" Note="Similar to TUBB5: Tubulin beta-5 chain (Arabidopsis thaliana)" AED:0.0406976744186047 QI:0|-1|0|1|-1|0|1|0|429
Sequence
MGYNFQRFRSNVIPSKTAMAQAHTTIASSKSRQRPVAKFTPFDEDKRELMELTMDSLRKL
IESTDCYQGTVLMHSLGGGTGSGLGCRLMELIRDTYPKAYLVAASVAPSWKWGDTPLQNY
NSVFTLAHLQEHADCIIYKENDELLRTAGYWKALLRAQTQEQSQQDNLIGNLASSGPPSY
RVSIDEMNHLAAADLAGLLFPLVPESKIAPSRAASALPFDFGKLIHDLCPLHSAKFLDVR
TGVLTGKSSSSCSASTKASKSDPALFHAGICQHPLTLRSGSDDEIESTLNKLVRQTAQSF
PRSASHTLSSSAIIRGFPSSNDCNRSTKLQAAVASAFPGVSWNSDYHIAVSHSSSTPFPS
NGGKASITLCVNNGHVLTSAEQYLQRAERQFKARAYVHWYMQHGLEEAHFQDVFEKSRQL
IAEYKDLLR
Download sequence
Identical sequences K3WGQ6
PYU1_T004147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]