SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004158 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004158
Domain Number 1 Region: 108-196,434-480,509-573,1148-1387
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.09e-45
Family Calcium ATPase, transmembrane domain M 0.02
Further Details:      
 
Domain Number 2 Region: 568-591,797-909,1072-1143
Classification Level Classification E-value
Superfamily HAD-like 1.76e-30
Family Meta-cation ATPase, catalytic domain P 0.028
Further Details:      
 
Domain Number 3 Region: 585-601,656-865
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.11e-21
Family Metal cation-transporting ATPase, ATP-binding domain N 0.011
Further Details:      
 
Domain Number 4 Region: 202-236
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0000157
Family Calcium ATPase, transduction domain A 0.0076
Further Details:      
 
Weak hits

Sequence:  PYU1_T004158
Domain Number - Region: 287-312,392-428
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0157
Family Calcium ATPase, transduction domain A 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004158
Sequence length 1557
Comment protein Name="PYU1_T004158" Note="Similar to ATP8A1: Probable phospholipid-transporting ATPase IA (Homo sapiens)" AED:0.104447919011492 QI:0|0|0|0.5|1|1|2|0|1557
Sequence
MMSSTGTRPRNAPSLHAGGGASAGAPRGRKADPHTHARTQRKPPPPSRVISIDRPKLLTR
ARETGDEQSSETTLGDLQERFFGKSRTRWRPSAAGAGDDSGDGDGAAFANNVVVSAKYTL
WNFVPRVLLAQVKRPSNIYFLFIAVLQTIKEVSNTNGVPTILLPLVIVFICSAIKEALED
RERHRADAIMNSKEVLCLSAMGEWEMKQWGDVQVGDIVKVLNDETVPADLFMLSTEELED
PDADVIESRDATQEDSTENDQEKYQQIDLSGTNASATPAASHSSGGGHLAYIETKSLDGE
TNLKIRTAIPLVAMLSKTLSDLLALRGTIECEAPNNRIATFDGSFSVELNNVQASVLGLN
ADAEGEISSLPRAGQSSRHLQRQVMTKPDGSRSIRVPITAKQMVLRSCVLRNTRSIVGIA
IFTGHETKVFCSNTDPVVKTSSVEQRLNTLIIGVVFIQQLVCLLGALLGAYWMITQGRSY
WYLRGESVDSTSAEYFRGRHAHDDGSFPFQELIKLHLRYFIIMQNFVPISLNVSLEFVKY
WQAYFIEQDLEMYDDTSDTPALVRSSALNEDLGRVHHIFTDKTGTLTMNLMLFRFCMING
KHYGGEVQESEIGGTPSSASALQLTKNQDKRGGSPFVNFDPTDLFTDLRAGGSHADQIRL
FLRHLALCHTLIPAKPLKDMCASPSPEYSASSPDEQALVSAAAHCNVRFVHRTPSAMMIM
EPGFDEPSTYKILHLLEFDSDRKRMSVILETPEGEIELLCKGADNVILERLTPTDDPAHV
DKVYDQLSLYAKCGMRTLCLAYKKLDRAEYAAWNTHYVSATSSMDELVKRRQGLPNAIDP
LMNEIEQNLTLLGVTAVQDKLQDGVPSTLQLLRQTHMKIWTLTGDKMETAINIGYACSML
TSKMEVLQVSSEDYVAVARGLQDAAMRQEKLLAKSRASRLREAKRQRRMGRVTNATWYEQ
WKASLSTFLFGVSLKKKHSRGRLPIRQAGLRGSGTYSPVSTLEYDDLEGDDADDSLLWGS
GPLAGFDTPNGSSSSLPSLALVIDGKSLEHALRPRLRPLFYQVTKMCTSVICCRVSPKQK
ADIVEFVRHYEPESITLAIGDGANDVGMIQAAHIGVGISGQEGMQAVNSSDYAIGQFRFL
QRLLFVHGRWAYRRVTKLMSYMLYKNVTYVLTTFWFGCFCGFSGQPLILDVAAQSFNVLY
TSLPLVLFAVFDQDISSQSASKFPYLYSLGQKNVLLTRKVFWPWILNGVWHSVIIFFISA
WGFQGDLSLSTHRVHHPATVSSNGQEDGLITLGFVVFTNLVIVVNLKLVLETFMVTWHFL
TVVFASVALWFAVGTLISSPTSHFRQAVGELTYLEHLPTFWALCFLVVTLSLMRDLLWKI
VRRMNFPSTYHILQEREMLSMTNSPRSMRNEYKGLMWPDVQVPILDYAKMLRQIPPFESA
QESFIRSSPLAESLISTNGGGGTDTEARHIRSRASFHVSGSYDDDEYGFWEEGHGLHHHH
SFDETHMASPAKVLDAEVQRSQYHGYAFSEDENVDSDVEAASAKQAALGQQVQADEL
Download sequence
Identical sequences K3WGR7
PYU1_T004158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]