SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004218 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004218
Domain Number 1 Region: 115-227
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.12e-29
Family Canonical RBD 0.0001
Further Details:      
 
Domain Number 2 Region: 8-47
Classification Level Classification E-value
Superfamily WW domain 0.0000000000415
Family WW domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004218
Sequence length 247
Comment protein Name="PYU1_T004218" Note="Similar to brunol4: CUG-BP- and ETR-3-like factor 4 (Danio rerio)" AED:0.0501232539030403 QI:0|0.8|0.83|1|1|1|6|351|247
Sequence
MADQVDVQVADGAAALGSQWSEHSAPNGRKYYYNGVTGESTWERPAELSAPQAELPRAGG
AAQAGAGAAAGGFPQAQQAPAQGQQGAAAYGQYPQAYGQPMAYPNPYSGAGYMYPYAQPY
GYAPQVAGPGPPIQTTESGQGPPGCNLFVFHIPNDMTNQDLFNYFATFGNVISARIMVEK
ETGRSRGFGFVSYDNAPSADAAIAGMNGFQVGRKRLKVQHKKEKGQFGDDSGAGDMAPPG
PSALPTV
Download sequence
Identical sequences K3WGX7
PYU1_T004218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]