SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004249 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004249
Domain Number 1 Region: 94-141
Classification Level Classification E-value
Superfamily F-box domain 0.000000000752
Family F-box domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004249
Sequence length 196
Comment protein Name="PYU1_T004249" Note="Protein of unknown function" AED:0.169982777374909 QI:0|-1|0|1|-1|1|1|0|196
Sequence
MDFSLPLEAHGVTHNRAPSSSSSSPTSTALIVHPLSLFNTVRSPTCGQDLLIKYNLQLQE
MQQLYEQQQRAAAMDADAKPRRRACLLEFTCDENVRSILGYLDGASLAATQRVNRYFHQL
SGDDMYWYNLCKAEWAIAPEQLQTRPASYQALYKFACQSLKKMIREFFEEQCLSSMQKSF
RIPRDTALMIARRSVF
Download sequence
Identical sequences K3WH08
PYU1_T004249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]