SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004277 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T004277
Domain Number - Region: 114-160
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0126
Family Capz alpha-1 subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004277
Sequence length 174
Comment protein Name="PYU1_T004277" Note="Similar to Med8: Mediator of RNA polymerase II transcription subunit 8 (Mus musculus)" AED:0.0323426573426573 QI:10|1|0.5|1|1|1|2|0|174
Sequence
MQVGAGGGDVERALSSIRARADHLRHTVARLEHNLAWNPASTWPELLSQYMVIAKQLENM
NEEIPDLLQHFACVPRLATPNPADIPLLLRTREDPEMEEDDRQLMTDKPRDKNAEALQKM
KNSHNEVVESLEETFREMSEGLMKSIRVNKYVTKTKPPSTQSHQFKFIESGSYE
Download sequence
Identical sequences K3WH36
PYU1_T004277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]