SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004318 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004318
Domain Number 1 Region: 17-267
Classification Level Classification E-value
Superfamily DNase I-like 1.44e-25
Family DNase I-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004318
Sequence length 533
Comment protein Name="PYU1_T004318" Note="Similar to DDB_G0271670: Uncharacterized protein DDB_G0271670 (Dictyostelium discoideum)" AED:0.0491196349390848 QI:0|1|0|1|1|1|2|0|533
Sequence
MTTLAAQLVNADDGVVVRVMSFNVRTNYAPEDKLADCTNWDALRKENAASQIRTVAPDFV
GTQETSDAQKAFFDGALAGTYAAIGKSGGSLNGNADEINAIYYKTSDWKNLGDGMFWFGP
NPDAPSAAWNMKYYRTAVWGRFQHIASGQTMCVFNTHYETPGNDEAQTQASLLLLAKLPA
ICQATDKINVITGDFNAPPTYPAMIKLFQGGLEEPSLEPTYCGWGPTCDVKYDYTLHTVK
DGACYTKSEVLRTSFNGCYPSDHAALLGTFCLGGSCCNTTPSPSPVTNSSLSSSSLSSSA
GSMYTDRSATNEDNVIPGTVSAGGTDAAIGEENVLRAGGGGSAASEAATQVINTKSTPGE
SGATGTVMAVLGVVGATAGVVFVVMRRKKKAIDARLDSEKAGTAPAPSYFARQQESDSND
LSPLPPSDAALSPFRVSNSPIPTLWDGGKENRDSRSSSVSYRGPSPSNQEDPYGRDSSTA
FLHDSSSNYSISAGSYNSGLQESRIHFSEAFRPDSLDSNGGALTKSQTDFALL
Download sequence
Identical sequences K3WH76
PYU1_T004318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]