SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004332 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004332
Domain Number 1 Region: 185-298
Classification Level Classification E-value
Superfamily Acid proteases 5.25e-23
Family Retroviral protease (retropepsin) 0.03
Further Details:      
 
Domain Number 2 Region: 351-405
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000234
Family UBA domain 0.016
Further Details:      
 
Domain Number 3 Region: 1-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000101
Family Ubiquitin-related 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004332
Sequence length 407
Comment protein Name="PYU1_T004332" Note="Similar to DDI1: DNA damage-inducible protein 1 (Chaetomium globosum)" AED:0.160297676473359 QI:12|0.58|0.53|0.69|1|1|13|99|407
Sequence
MQLTITSAEGDVVGQIAVEPHQTTAAIAAQLQQQFGIPPVLQLLLFNGIPIGPTQTFEQA
GVKDDDLLVIMRSPNAAAAVPAPAAPSSLLPNTGGFIVRTGMKLHEIPPAASPEVLLEIM
EKNPQLMPELEEGNPKLAAALKTKSVPQVRMVMALERNPFDAAAQAAIEERIRLNNVQQN
MEIAIEEMPEAFGHVSMLYIPCEVNGTQVKAFVDSGAQSTIMSSNCAERCGIMRLVDKRF
AGQAVGVGTAKIIGRVHMASLKIGDNFYNCSFTILDQQSVDFLFGLDMLKRHLCCIDLQK
NVLRLQEGAISHEVAFLPEHEIPVTERAGGAPPQEASPSSSAAPPAAAAPPAPAAQPSNA
ASGDESHQQKVERLVALGFDQQRAIQALASTNGNVELAAGLLFETMG
Download sequence
Identical sequences K3WH90
PYU1_T004332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]