SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004370 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004370
Domain Number 1 Region: 443-637
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.71e-63
Family Pyruvate oxidase and decarboxylase PP module 0.00000115
Further Details:      
 
Domain Number 2 Region: 70-243
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.36e-61
Family Pyruvate oxidase and decarboxylase Pyr module 0.000000381
Further Details:      
 
Domain Number 3 Region: 264-432
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 6.06e-57
Family Pyruvate oxidase and decarboxylase, middle domain 0.00000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004370
Sequence length 650
Comment protein Name="PYU1_T004370" Note="Similar to ILV2: Acetolactate synthase, mitochondrial (Cryptococcus neoformans)" AED:0.0722288669222921 QI:0|-1|0|1|-1|1|1|0|650
Sequence
MLRGRHLSRALRAAAASRRAAPDAVAKRVLRAAASSTLWNGAAQTRALSTQDHTDKVKRT
PKMTDEFIGKTGAEIFHETLADLGVDVVFGYPGGAILPVFDAIHESDKFDFILTRHEQNA
GHMAQGYARATGKPGVVLVTSGPGATNTVTPLQDALMDGTPMVVFSGQVATAVLGSDAFQ
EADILGITRPCTKWNVQVRNVKDLARNIREAFHIATTGRPGPVLVDLPKDITAGLCKTPV
TTEPQLLGYYGQTKTPGNRVNQEANLAKAIEMINKAKKPVIYSGAGCNHAAEELRALARQ
GNIPVTTSLQGMGSFDERDPLSLHMLGMHGSVYANKAIQDADVVIAIGARFDDRVTGRVP
DFAPEAKRAAAEGRGGIIHFEISGKQVGKIVTPQVAVIGDTKYNLQQILPKIESKPRTEW
HKKLQGWKARYPFRYRPSAPGAPMKAQRVIEELYTQTKGRDDVIISTGVGQHQMWAAQFY
RWSRPNSIITSGGLGTMGFGLPAAIGAKVAKPDALVVDIDGDASFAMTLTEMATAAQYGI
GVKVMILNNDFQGMVKQWQDLFYEERYSGTPMKNPDFVKFAESMHCQGLRCSEESELEEA
MAKFLAADGPIIGEFLVEKHEHCYPMVGAGRALDEMIIGDFDDCPPTTSV
Download sequence
Identical sequences K3WHC8
PYU1_T004370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]