SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004421 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004421
Domain Number 1 Region: 279-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000158
Family SPRY domain 0.047
Further Details:      
 
Weak hits

Sequence:  PYU1_T004421
Domain Number - Region: 160-213
Classification Level Classification E-value
Superfamily F-box domain 0.00157
Family F-box domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004421
Sequence length 441
Comment protein Name="PYU1_T004421" Note="Similar to RANBP10: Ran-binding protein 10 (Bos taurus)" AED:0.168552036199095 QI:0|-1|0|1|-1|1|1|0|441
Sequence
MVSVCSFGSELPMQSKLRTYVVLTAKPRTKHLPRTCSSISTTSSNSSTASEDEDDDDDDA
YLVGDGFSSLGLDCNMAYESYAAVASRYNASNNGRNGSSPRELRWSDLNLKSRGPRVELS
KFMTTKTSQKARKRYLKKGAANTAAVAHNEDNGLFAMHTLELCLEFLNVQDLQNGTLVCS
EFYKIITSTKRLLPSLYSQKWRPFTTQALPPAYLKASYQDQLKMCLNRKPVIEYPLVTRS
SVKQNPVNGMYEIHNNSMLRSFERGSVDSVRGTKALPVLPCAQALQKQISYYEVSMKGSG
SVGVASISDEDSRNAYGFGSEEHLGWKGISYGYHGNDGDFVYNDGTAPYGGEWTPLGPSW
GAVGGQDDKDAATFTIGCGFNHTTGQLFFTLNGKLAGIAPVAILKGEYAAAVSLHSYGDS
ATLNVGTVPFLFDVESFCASP
Download sequence
Identical sequences K3WHH9
PYU1_T004421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]