SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004437 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004437
Domain Number 1 Region: 260-315
Classification Level Classification E-value
Superfamily RING/U-box 1.19e-16
Family RING finger domain, C3HC4 0.0055
Further Details:      
 
Domain Number 2 Region: 40-72,101-157
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000000631
Family FHA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004437
Sequence length 483
Comment protein Name="PYU1_T004437" Note="Similar to RNF8: E3 ubiquitin-protein ligase RNF8 (Bos taurus)" AED:0.0464876033057851 QI:0|-1|0|1|-1|1|1|0|483
Sequence
MMTPPRSSRARSTRETSNSGSGANTPVEEEPLRSVWSFVHAFTIGRSRSSDVVIPTTDKT
RTISKAHVRIFPVRDSGRSSSINIASPTSFSTHRGSTAYDRKATRWMLQDLEAMNGTSLN
GFDLPLSGCAELHDGDEMVLASMMRHGVRITVHFPYEDSSSIRVKLVEQTATSTPTPERR
SSNQSSANGTVRRLGFETPTSHTSTTPRYSSSTVATKRERYQRGDTSERRYGRHTSSDNN
ELMENADEEVVRRKRTRRLEELDDQERCMVCPICFEYFHSSVTLPCSHTFCGFCVSNWFR
ASLSCPHCRTDVKTLPVRNRALDDLVQRLVGETDAYKALIAKRMQFQSQLQTREPQPEPR
PQSSAAPFRSPFLSDSPRTTTPTRTTSSNTVTRTSSSTSESLPNVFTRWSPDEIARVRSI
VGKQFGETRLQTCRNMGLTEATMARASTSQTAIAMQNLLLDWWPYERVRDEGDHRLKIFL
HFG
Download sequence
Identical sequences K3WHJ5
PYU1_T004437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]