SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004443 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004443
Domain Number 1 Region: 144-181
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000000683
Family Leucine zipper domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004443
Sequence length 434
Comment protein Name="PYU1_T004443" Note="Similar to Transcription factor HBP-1b(c38) (Triticum aestivum)" AED:0.124709967320261 QI:0|0.83|0.57|1|1|1|7|295|434
Sequence
MELTPEDDDLLSYFLSADVASEEPPPQPKPDALNAAGTAPLYPTLGGGVSGVGAAPSGSE
QFTFGAPQDRAFGQGATSASGAGAGAVGTAGGSAAGVSNLAMPGPLSTLQQMQNAYHAAE
NAMMRSSSADEDAMSGAGLDSDEKRQRRLARNRESARQSRRRKKQYLELLEEKVSQLTES
IDATRASHLERADESLNNVRSEILATLAEDMKNNPPEAVSEKIRQGIMLIQERFGPNSVE
RMAVKDYNFRQLDNLLLPPYSRFLLWLSIQDETFFDEANGLAAKAGGDNVDKKKPPVVVK
KDTLWPTLIGDLALTYEQDEKLKSLYKSGDSKTSKSERRRIALAVTYLSKLKNSLEQRSE
AVQRHTEMIHSILTPEQSLTYLRWVDANQDRLPNFIDRSMTMSNTGSSEAVRTILKKNDR
DLTVEDVTALLAEL
Download sequence
Identical sequences K3WHK1
PYU1_T004443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]