SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004448 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004448
Domain Number 1 Region: 75-137
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000547
Family Centromere-binding 0.0059
Further Details:      
 
Domain Number 2 Region: 8-57
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000314
Family Centromere-binding 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004448
Sequence length 371
Comment protein Name="PYU1_T004448" Note="Similar to CENPB: Major centromere autoantigen B (Cricetulus griseus)" AED:0.19758064516129 QI:0|-1|0|1|-1|1|1|0|371
Sequence
MGKQGHGRRLTDKERMEIIELTRQNPRIKHVELATKYSVNESTIRKWRQKANADKIETRY
ESGVEAARDVRQRGQAVKNAAFDTTMYEWICSMRSQSIDLPPVKIREKARQLAESYDGMQ
DFKASSGWYYRFCRRYGLPCPSSKREADASLSAGNEAVVAATEDADAAAGDLQSAVIAES
EPERAISALHESHAEHTTNEESGTVVLNGSLAEPTDAPSVFDAASYEPMESISTSVAGKR
KFDDTIGGNNSGENVNESGGGGVPDTIATPPKDDVAPVANDPSTRFLAPATSTSQLTTRQ
EAIAHFLHYHKDLLSVPSRLRFIKHLAHVAGEAEMYSVMDDETRIELIKEFVDKDDSASI
PVGAESEGLVV
Download sequence
Identical sequences K3WHK6
PYU1_T004448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]