SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004506 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004506
Domain Number 1 Region: 143-227
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 7.63e-28
Family SWIB/MDM2 domain 0.00092
Further Details:      
 
Domain Number 2 Region: 275-362
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 3.05e-25
Family SWIB/MDM2 domain 0.001
Further Details:      
 
Domain Number 3 Region: 25-77
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.000000000288
Family DEK C-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004506
Sequence length 400
Comment protein Name="PYU1_T004506" Note="Similar to spp27: Upstream activation factor subunit spp27 (Schizosaccharomyces pombe)" AED:0.0037406483790523 QI:0|-1|0|1|-1|1|1|0|400
Sequence
MNDSGIGLELELGIGSDTSLPMVDEAQLTDAIRTILQDADLEQLSRRMIRKQLEAQFHMD
LSHYKDMINATILELIEQQTQQQEEDDADDAQEPEPSDDEEDEDADDEYDAQPRKKAKTA
AKKKATPVKRKRAAPSANGEKTSNAFNMLLSLSPELASVVGSETMARPQIVKSLWEYIRE
HNLQDPNNKRHIIFDDKLRRVFQRDSVTMFSMNKFVKRHVRKPEDLPPNGWTDIHRDGVS
SDEDADGKAAKKKASSAKRKKKSSAGDDDDEDGGKKTKRSNPFNTELAISPELAAVVGSD
RMARPQIVKSLWEYIHAHNLQDPSDKRTIILDHTLRQVFQRDSVTMFSMNKYIKRHARKP
EDVPAGGWAAIPRDGLSSDEDESKKPKKKSKKAIKQEQDE
Download sequence
Identical sequences K3WHR4
PYU1_T004506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]