SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004523 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004523
Domain Number 1 Region: 282-817
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.92e-134
Family Tandem AAA-ATPase domain 0.053
Further Details:      
 
Domain Number 2 Region: 2-68
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000053
Family Cold shock DNA-binding domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004523
Sequence length 947
Comment protein Name="PYU1_T004523" Note="Similar to At3g26560: Probable pre-mRNA-splicing factor ATP-dependent RNA helicase (Arabidopsis thaliana)" AED:0.10910387616508 QI:0|-1|0|1|-1|1|1|0|947
Sequence
MDFGVFVELDEFTAEKKEGLVHVSNISTQRIANVKDHFRRGQRVKVKVISNSGGKLSLSI
RDVDQQSGKDLVPMRSNDGAQRARLDNSSTDHRSWINPSAPGMHSSHQHDDDDDKPQRAA
KRMSSPERWEARQLINSGVLSIEDYPTFDEDHGLMDVEPTEENFEVELNEDEPIFLRGQT
LLNRDASPVKIVKNPDGSLQRAAMTQSNLAKERRELRQTQANQLIDSIPKDLNRPWEDPM
PEAGERHFAQELRGINMGSTFEMPEWKQKSVGKNLSYGIVSNKTIREQRESLPVYKLKRQ
LMKAIAENQVLVVIGETGSGKTTQMTQYMAEMGLTSTGIIGCTQPRRVAASSVAKRVAEE
FGCELGQEVGYSMRFEDCTSPETVIKYMTEGMLLREYLADNTLSKYSALMLDEAHERTIN
TDVLFGLLKDLVRKRKDLKIIVTSATLDAEKFSRYFFDCPIFTIPGRTFPVEILYTKEPE
LDYLDASLLCVMQIHLSEPEGDILLFLTGQEEIDTACEVLYQRIKSLQERALAPELIILP
VYGALPSEMQSRIFEPAPKGSRKCVVATNIAEASLTIDGIYYVVDPGFCKQNAFNSKIGM
DSLVVVPCSQASARQRAGRAGRTGPGKCYRLYTENAYKNEMLPTTVPEIQRANLGSVVLQ
LKAMGINDLMGFDFMDPPPQQALVMALENLYGLGALDDEGLLTRLGKKMAEFPVEPKNAK
VLLTSVVLGCAEEVLTIVAMLSVETVFFRPKEKQAQADQKKAKFHQPEGDHLTLLAVYEA
WKNSKFSNPWCFDNFIQARAIRRAQDVRKQLLSILDRYKMDVVSCGKNFNKVRRAIVAGY
FANTAKKDPQEGYRTMVEGQPVYIHPSSALFNKSPEWVLYHELVLTTKEYMRNIMTIDPK
WLVELAPAFFKKGDPTKLTKRKRNEKIEPLYDRFNPPDAWRLSKRRG
Download sequence
Identical sequences K3WHT1
PYU1_T004523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]