SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004554 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004554
Domain Number 1 Region: 7-179
Classification Level Classification E-value
Superfamily eIF4e-like 2.49e-41
Family Translation initiation factor eIF4e 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004554
Sequence length 195
Comment protein Name="PYU1_T004554" Note="Similar to tif452: Eukaryotic translation initiation factor 4E-2 (Schizosaccharomyces pombe)" AED:0.164791205165669 QI:0|1|0.75|1|1|1|4|0|195
Sequence
MASGDDERHELHTGWSIWEQRELGKGMAYGDKLFKLCSFRTVEEFWAYWNNIPKPSQVLF
DGFTKKKFADRTVESFAVFKDGITPEWEDPENKRGGEWSIRKEIGSEALDEFWDKLVLGA
IGETIDPGNEITGVRVIHKNKRDKKEPGNNYRFEIWLRTLDRARADEIRGLVLNCMNTNN
TGPAWTTREFVYKNH
Download sequence
Identical sequences K3WHW2
PYU1_T004554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]