SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004557 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004557
Domain Number 1 Region: 220-317
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.67e-23
Family Synaptotagmin-like (S variant) 0.032
Further Details:      
 
Domain Number 2 Region: 3-102
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.28e-21
Family PLC-like (P variant) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004557
Sequence length 480
Comment protein Name="PYU1_T004557" Note="Similar to MCTP1: Multiple C2 and transmembrane domain-containing protein 1 (Homo sapiens)" AED:0.123654529617832 QI:0|0|0|1|1|1|2|0|480
Sequence
MPVLYVKLHRATDLAASDFSFMGGKSDPYVLVEVERQQEKSACIKSNLNPVWSPAERFRF
DIEDVNRAVLGVKVFDYDALNQDDLLGSLVIPLSRFANMMDQSFLEVFALDVPAEFAKQD
RPSTIELEICLKNEDDGDTTLTIWENETWSIGSGWSAADSKDRQQWSTHDESKSSAHFND
VAPLVPSHLEGGGWEYCAKKGDMNGWVYATSWAERHAQMACSHVVRVTLTHATRLAQGDY
IGKSDPYIKFTVDEQSARSSCRASTLDPVWDPPEHFDFKVLNPEEQCVRVDVFDHDLITR
DDHLGSVSIPLKDFITEDTNNALPDAATTGRKELPPSKGYTLDVPPSLKTVEPSQVFLRI
AVTPLDLTEVRLEVWENECWSLSSGWSSDVSIFLFSHRTRWSNEDGSHSATKFEEIAAKP
PLGFQSQGWNFHVGKGDCDGWLYAVSFSGPWYAVSNPTTLVRHRRWENMCRRPGSTKILT
Download sequence
Identical sequences K3WHW5
PYU1_T004557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]