SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004564 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004564
Domain Number 1 Region: 289-351
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.96e-17
Family Cytochrome b5 0.0031
Further Details:      
 
Domain Number 2 Region: 189-274
Classification Level Classification E-value
Superfamily F-box domain 2.62e-16
Family F-box domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004564
Sequence length 417
Comment protein Name="PYU1_T004564" Note="Similar to Cyt-b5: Cytochrome b5 (Musca domestica)" AED:0.402885268650891 QI:0|-1|0|1|-1|1|1|0|417
Sequence
MSALPAPRPVAYCRSNSSSNDEAVAVAGLGLPRMPVLVNSPRHKEADDATAPVVVVPPNV
TKGNRLVQFMVFSAVACTLYQFVTHGSSQLTMKTDTTVGAQFGSSEYTCILACMGLFGLI
RHKAKEAKKRAVDEEVEDEDDELTRELRLTEKLVRNQRKHTGKNENVAAIKKNRQSPTNA
CKNAVADTDVLSNQQQPPGIEALPLDVLHELLLFLSPKDLAACPMVSKQMNVVTGDASDS
LWRLVFQRDFEETGERFQVVFPIESWRQFYFQHHLSRAVEIARLLGLQEDKKCVAIEDHV
YDVTAFLHSHPGGYHVIGDVIGTDATEIWDQFQHSQEAKESMKEFMVDDPILCNREAHPR
LHGNLAIVITRWQRISWCITNAHNFGPMASTFTDVVLRFHARSIKKSRDLATPRVSN
Download sequence
Identical sequences K3WHX2
PYU1_T004564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]