SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004603 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004603
Domain Number 1 Region: 704-736
Classification Level Classification E-value
Superfamily WW domain 0.000000000148
Family WW domain 0.0017
Further Details:      
 
Domain Number 2 Region: 406-470
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000354
Family Synaptotagmin-like (S variant) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004603
Sequence length 766
Comment protein Name="PYU1_T004603" Note="Similar to mnmE: tRNA modification GTPase mnmE (Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995))" AED:0.110526840128732 QI:0|0|0|0.75|0.66|0.75|4|0|766
Sequence
MLMRYNKIQEIEKRFDQALFNLLRLCQGHQNYLITVALDKKDLIVRVREPIFKFQMDFVL
DEDEFARAKLLSHLPTLHTEHFSGHNNGTREQKLVASPNAVITATCLPEANEAMLSLLSR
LRIAANANTATHNHQGMIPFLKLVESDRFISALRELLVQATLPFFWSVSPKLLEFSIDGD
YFDQLNRPSFQHVVAEALSRKSSSTRTLVSLLKHTSSSLQVRYEIIGRNAIFLSSWEEFQ
SVLTGHQDTYAIVEVRPQGDVFATDIDRTGASGAPKWNFKKKVILKEPSCCDLRIDRPVV
YTDTVKVSAVPGGHATKKITFIVDDKSDNGHFVVLSVRKAQPSAQNEKARLYCTAYDPFT
SCEYAIEGYPPDWPADFFANSDRNFEKEWIALLKMMSLGITLTPKVLVKVFNKQAKTEKL
LGECEIAISSAIAHEGHIFEDWFPLQHPMDSLKTTGFVNLAVRFELKKASELPLAIIEDD
AQKRRRSIFVPVEVSGTALDVESKATSPAEDTDKRQLETQFQELKQSLSMAESAKRDAVE
QVKNLKLQLQQVGMASTATGDEVMRWKKKLDQAIKEQSLQQEQHDLRVAALQTQLQRVEE
SAQRERESLRKPPPPVMITNLKQASLGMNASAHDILSAMKDILVNRCPERPYNGLKKALA
AIAEVPGKEISIDLRDAAPPSSPTHPMSRPKKMSWKEMKKFLMMNLPDGWETRFTEKGKP
YFCNHSQRSTQWKHPKPEIETIFKEWLQENGPNFSSSTMTSSSRRH
Download sequence
Identical sequences K3WI11
PYU1_T004603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]