SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004647 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T004647
Domain Number - Region: 315-371
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00188
Family Centromere-binding 0.068
Further Details:      
 
Domain Number - Region: 157-220
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0188
Family Centromere-binding 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004647
Sequence length 401
Comment protein Name="PYU1_T004647" Note="Similar to paxip1: PAX-interacting protein 1 (Xenopus laevis)" AED:1 QI:0|0|0|0|1|1|2|0|401
Sequence
MAKKAMAMAMATHRRRMTLDEEARVYAHYVSNPLVSMAALAEWAAALFRLDKVPAESTMV
SLVQWYKEHPERSGGGAGDASEHAGGYRIEEEEEEEEEEEIDEREERDGETQDNATTPIT
STTTMTAPTTPKRGRKPKGTGAPAGTTIQSAIISKLYATLEPELQEWLVEVETRGESPSV
QEIRKKAATIRDRLLKNHPRPKTIQKSMKFTVEWVRKFQEQCYNQKDASQQLSQMAATQL
SSFADAALTSAQTAPPRQSAPPSRIIRMIPDAPLVAKKVVPRLPIKPKGRAIPRPTAAEA
AATTTTTGIMATSSGKVRGKHMTKEQKDRIYEQYQADPMMSLQELANWAAAEFQLSKTPS
VSTVSNVLKQHQERPDQRHECYIRCYCYYSVYDGNDGGLYW
Download sequence
Identical sequences K3WI55
PYU1_T004647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]