SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004648 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004648
Domain Number 1 Region: 311-385
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000143
Family Centromere-binding 0.007
Further Details:      
 
Domain Number 2 Region: 135-207
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000152
Family Centromere-binding 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004648
Sequence length 415
Comment protein Name="PYU1_T004648" Note="Similar to TIGD2: Tigger transposable element-derived protein 2 (Homo sapiens)" AED:0.0988825363825364 QI:0|-1|0|1|-1|1|1|0|415
Sequence
MGWLQVFQDKYNLPTYEKPSENAAQTTGAKRGRDEFGTFNGSNRPGPSIEHRSKRARMTY
GEKAQLYAYHLANPSVTRYWLGEWAASQFNLVTVPSESSISKLLRKQREIHENPDRMAEG
IDGTSSFMNTDARKKTYKVTCPALESELIRWIYECRSRGEQVGGKLVQQKAHALRDLLLQ
ENRPDIDHNALAAMTFSQGWLYRFQTKFELLTRRNKTKAKKKELSRPKYLLRTHMTLEEK
ERLYEQYQTDPSMKMTALADWATNEFKLAKPPSRSTMSGIIKRYKERLAAGINTEDEDSP
IQRADAATRKKYTTVVCPQLEKELLKWVLSCKMKGENVSGKAIAAKAAALRDELLTEQRY
HPRHEVLADMTFSNGWLYRFQQRYGIFSRAKRSTTTSVRTVRKNPAARGRVTKKR
Download sequence
Identical sequences K3WI56
PYU1_T004648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]