SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004679 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004679
Domain Number 1 Region: 516-865
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.4e-59
Family RNB domain-like 0.00012
Further Details:      
 
Weak hits

Sequence:  PYU1_T004679
Domain Number - Region: 473-526
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000188
Family Cold shock DNA-binding domain-like 0.0051
Further Details:      
 
Domain Number - Region: 446-483
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000857
Family Cold shock DNA-binding domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004679
Sequence length 967
Comment protein Name="PYU1_T004679" Note="Similar to Dis3l2: DIS3-like exonuclease 2 (Mus musculus)" AED:0.261370509669367 QI:0|0|0|1|1|1|3|0|967
Sequence
MEHRKKKSSHGGDAGAKRGKGGGGAKRVLVLWADAQHDGDGDDDSAGEEARTGATKANQT
DRETSSSGSTAAAGGGSDDGIGRKKKAKNEERVATEELKPLVNVVTKNATTEATMDGKTK
QQQKQTKNKEHKHKKPEKVKGALLQKIQEDKDKKKEKKEKKKKAKQEKRARKQADVDRDD
HINADVAFDSEEIESDDDDDLFGEASANMFEAHGFVMIDIENELDELALIADMATGEGAH
SVQGASKKEGKKKKKQVKKTEAAFAKQAKKKGKVDSADISLHAGNDLLSKADALVTASFQ
EQKPKLPKTQKQKLKKVAGNEKVHGALGSKAEAQTNELLEQEEPKLSKKQKQKLKKAARA
EAASVMVETSAKSEQTNHEGKHAETTSINVEKKIAKFEKKDKKAKVNVTEVKIEENSETV
DIRKERGRRSQTDNGKRKSDDHNSASYEEYVDRELVLKGLEDGTFLQGKLRVNSKYRLDG
YTMLCFCRIKSWSTKYKSPMGEFVKTVGEFSGIESGISAILTKHGLLSHTLDFDSGILED
LDEKYGISGEKWVIPDEELQKRRDFRKYQIFSIDPYNARDLDDALHKMLDGVITSDNVEE
WEEARRPIVGENPLITNASVIQSVKDLWTIGKCRREMRFDTGAISLNNVKIVFSLDAKGN
PVSYGGYQLKDSNRLVEEYMLMANYLVAQQLLRTHGPLAFIRNHPQPIAQAMEQTLATLQ
ENKLEIDGSTTKSLSESLEQVRVKCGETAYIIAQAMIIKPMKPAEYMVAGNGDSAEAWRH
YALNIPYYTHFTSPIRRYADVVVHRLLQESVTCGESLPVNDPQRDVTELLQRFTAVSQNC
NEKKVTAKYAETECDLVLLCAYVKHHGAVEVTGIVMSMGPQSFTVYIMGLGLEERVFLKN
AQITGTWDEKTSNLAIRLRSNDNKSGKNSNDISKPIQLSFMKKLRLVMDATNKMPLKLTF
SVVGEAH
Download sequence
Identical sequences K3WI87
PYU1_T004679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]