SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004692 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004692
Domain Number 1 Region: 55-195
Classification Level Classification E-value
Superfamily Bet v1-like 1.41e-25
Family oligoketide cyclase/dehydrase-like 0.0015
Further Details:      
 
Domain Number 2 Region: 264-391,429-476
Classification Level Classification E-value
Superfamily EF-hand 8.14e-24
Family Calmodulin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004692
Sequence length 510
Comment protein Name="PYU1_T004692" Note="Similar to zgc:73324: Probable protein COQ10, mitochondrial (Danio rerio)" AED:0.0372561540838398 QI:0|1|0.33|1|1|1|3|0|510
Sequence
MLRSSCFPLSYHLRTAAASRSTRAGAALANGSSNRMRRPFFSFASPSHALVKSHKETKVV
PFSPEEMYDVVADVDKYHEFLPFCVESRVLRQPNENVMEAALKIGFKVFTESYTSRVIMK
RPEKIVVKAIESPTFKRIESEWVFRPTATPDTCAIDFKVTFEVASFLHANAIQLFFDDVA
VAQLNAFIRRAKKVYDTKSRAVRSTPHHQQQPLVRPPPISQGDSTFPIPRSMVQSAAGIS
TETGAHVHHPTGHTSAQRAADSVKMGISTQHFRDLEALFDRHSVDNGKMYFDEFMQASRE
LGGDYAEFRDVKSNSALAGAIFSSFGTSDPPKDWLNLDEFVVGVYLMTKGTIEEKARNLF
HVIDTTCDGKISREELTTAMQHRIRTVKKIFPKLLNDQVQIQMQHENVTTLSAQGHEAMS
NALKSIETLMEEIEKEIPLAVNQIFQEADLDQDDFITQDEWLFAWQAHPEFVELMTVDGM
KKFAQWASVVHGDDDDDDNSALDTRLTYVD
Download sequence
Identical sequences K3WIA0
PYU1_T004692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]