SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004720 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004720
Domain Number 1 Region: 322-606
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.1e-73
Family Tandem AAA-ATPase domain 0.0000237
Further Details:      
 
Domain Number 2 Region: 80-320
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.46e-62
Family Tandem AAA-ATPase domain 0.0000288
Further Details:      
 
Domain Number 3 Region: 818-940
Classification Level Classification E-value
Superfamily Homeodomain-like 1.04e-33
Family SLIDE domain 0.00048
Further Details:      
 
Domain Number 4 Region: 690-764
Classification Level Classification E-value
Superfamily HAND domain of the nucleosome remodeling ATPase ISWI 0.000000000288
Family HAND domain of the nucleosome remodeling ATPase ISWI 0.0029
Further Details:      
 
Weak hits

Sequence:  PYU1_T004720
Domain Number - Region: 766-812
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000663
Family Myb/SANT domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004720
Sequence length 1019
Comment protein Name="PYU1_T004720" Note="Similar to At3g06400: Putative chromatin-remodeling complex ATPase chain (Arabidopsis thaliana)" AED:0.0230844952070819 QI:0|0|0|1|1|0.5|2|0|1019
Sequence
ERNELKAEEKRQKDELAQKKSEIASARLKYLLSQSDIFAHFSGKVGKNKEKADDTDTSSG
KKKKRISEREEDESLLTDKHDVVRLTKQPSVIKFGTMRQYQLEGLSWMINLAHQGINGIL
ADEMGLGKTLQTISVLGYFLEFEKVSGPHIVLVPKSTLSNWLNEFNRWCPDLRAVKFHGD
KEERLRVINEVLCPGLPDKKRKFDVCVTTFEMCLKERTALCKFAWRYLIIDEAHRIKNEG
SQFSTVVRMLDTEHRLLLTGTPLQNNLHELWALLNFLLPDVFASSSEFDEWFNLDVDDDE
AKKQMIGQLHKILRPFMLRRLKADVEKSLPPKKETLLYVGMSTMQKTLYKSLLLRDMNTV
MGGAQGVSRSALQNIVMQLRKCCGHPYLFEGQEDRNLDPLGEHVIENCGKMVLMDKLLKK
LKQRGSRVLIFTQMTRILDVMEDFCRMRQYDYCRIDGQTSYEERESSIEEYNRPNSSKFI
FLLSTRAGGLGINLYTADVVILYDSDWNPQADLQAQDRAHRIGQKKEVNVYRLVTSDSVE
EKIIERAQQKLKLDAMVVQQGRLQEKQSKLSKNDMLEMIRFGADQVFRATDSNITDEDID
AILAKGEQRTEEMKKKMQVHDKGDMLDFKLDGGGCQNHDGIDYSNEKERQEELKRLAEAE
FARSLAEGMGKRERRTVIRQSNMPSDGKRSSNNKSKQLPKALRLPRMDEWQFYNRKRLLE
LHEIEYGNYEQAKQEMEKPPLPPHAQYLTAEELNEKEKLLREGFGDWNKPQFFLFIKLLA
RYGRANVEAVAREMGKPFEEVDRYAKVFLTRGQEELGDWPKILKSIEKGESKLLEIGRLT
EETARKVNRYSNPWEDMPINYQGKGGKVFTEEEDRVLLCLVNKFGYGSWEKIKEEISSLE
IFSFDYYLRSRTAAELGRRCDSLMRICEKDNADLEVKEKKEQEMRQQLMKQRESLDERLT
AAREELKQNQLRVDELIMKEAKRMQAQREAKRSKKRKERDEKDELVDRYADELAEFVVK
Download sequence
Identical sequences K3WIC8
PYU1_T004720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]