SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004747 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004747
Domain Number 1 Region: 158-203
Classification Level Classification E-value
Superfamily F-box domain 0.0000000131
Family F-box domain 0.0041
Further Details:      
 
Domain Number 2 Region: 361-419
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000183
Family Protein kinases, catalytic subunit 0.024
Further Details:      
 
Weak hits

Sequence:  PYU1_T004747
Domain Number - Region: 722-756
Classification Level Classification E-value
Superfamily RNI-like 0.00903
Family Cyclin A/CDK2-associated p19, Skp2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004747
Sequence length 813
Comment protein Name="PYU1_T004747" Note="Protein of unknown function" AED:0.214373464373464 QI:0|-1|0|1|-1|1|1|0|813
Sequence
MAHDKAEGSGDDECGSLISLNSDERSMDVDTEHRYHHHTARRWIHAIQNASFQPKPTAYS
PQGSLGEDPLWEKLRECQDKLAVLRQVRARVQFYPIAGMSNAIVAGSAAPPRKTIDIQTR
MIFSQMEEDDDSRSDTSPHPTRDAHSVGIDTLSGLETLVFGYLAPNELIRASGVCRSWKD
MARHDVIWEPRLFTPFERYPLREFLGLAADLPAMQVFMIFKRLRVSELPAEVGGGDNVTR
AAGEMLLRHQVPAYRGRLLDERERFRTWMQTRVDQQQQQPQQPQLDLTVRLDDNISRSTA
VAPRRNRNPVECVHLVCFHGQTPTSDAYEWPTAATTHHLQDQFPALFATIRGRGDRNDDE
IHCVKDGYRRSTLKTWLQHQHMVSERVLRSFLRQMLVAVTALEQAGVIHSDISTMTILVL
EPADALEEASEKGDGEKETTTGPIFQLLCSLNTWYCGRDLEVSHNSNARDQDGVQGEEQR
VDDPMMHRRRQDDDVAVIDIGGEDENAHDRVFNAMHAAAFGQARQLRPPCMLTSVFRCAV
SLYARGRFPDTTQSNSTTLLLLLSSQHMPLPSGFRACGEYAKFLLQTGSSSQSTSVAAQL
LNHEYVATRANARNNVVVPIRPTNVQTRVLVDYQASILAWYGTLQAQVQAQPADDQSIAL
DHADFSLNSHLLDLMPRTRMGAAYLEHALEEDKLPSERFVSIVAPVVKESSWVRVLSRTQ
RHTLQRLDLSNADLPTSVLLDELMNLPRITHLRLPSKIERPDDIEHFLAALSCRELLPNL
HAMDENVQAAMDRMEKTYVDQLGMLDFCLQSAK
Download sequence
Identical sequences K3WIF5
PYU1_T004747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]