SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004756 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004756
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.51e-31
Family PLC-like (P variant) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004756
Sequence length 132
Comment protein Name="PYU1_T004756" Note="Similar to MCTP2: Multiple C2 and transmembrane domain-containing protein 2 (Homo sapiens)" AED:0.0112220850634048 QI:0|-1|0|1|-1|1|1|0|132
Sequence
MPYKVQVTVAKAADLPAADFNGKSDPYVVLTLGEHTRKSSIVPADLNPTWDQKFWFLTED
PAFAVLEVQVFDHDRFTKDDLIGSTTIALSQFVDDENNAKMRMYDLVVPNFFEKQNRKSV
IMLEIQVEKDDE
Download sequence
Identical sequences K3WIG4
PYU1_T004756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]