SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004921 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004921
Domain Number 1 Region: 7-103
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000672
Family Homeodomain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004921
Sequence length 308
Comment protein Name="PYU1_T004921" Note="Protein of unknown function" AED:0.088155255317266 QI:6|-1|0|1|-1|0|1|0|308
Sequence
MRAQADRNACFRLRSKGFTLAQIAHALDICARTVQRWLKGESAAARPLNRNHTRKLTSLQ
EERLIEFFLDENTNRLRDGVTFVAQSFNLCVSEQTLGRILHRHRLSFKRAVSAYHEADRA
RQQVFLANLPRDSTKPWIALDEAAFFLNHSRKYAWSKRGTPAVVDRPSNRGRMHSLILTT
SPDGVVDWRLIEGSVDSLRFHAFLNGLPGDTNVLLDNCATHHPSYVLVKQGKTTVSQVAR
SKQMTLNYLPPYSPQLNPVEFCFNLIRTHVNRTAPRTLGSLHNCIQTAIRGLTPAVCRSM
FRKCLLIG
Download sequence
Identical sequences K3WIX9
PYU1_T004921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]