SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004931 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004931
Domain Number 1 Region: 47-136
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.1e-25
Family FHA domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004931
Sequence length 663
Comment protein Name="PYU1_T004931" Note="Similar to SLC4A1AP: Kanadaptin (Homo sapiens)" AED:0.0300980778328676 QI:0|0|0|1|1|1|3|0|663
Sequence
MATAPVYTPPEWGRDGANAFGIYMEVVKGGVIVENLALPMTSAKSGASCVVAGRMDPVCD
LVLQHPSVSRMHAVLQFDAQGALFLRDLNSTHGTFVNKRRVVVNEYVRLHIGDVIGFGES
TRLYAVCGPPELLPAEYDSLNLQKFREKSSTRQETKAKQREKLQKENEGASWGFGEDAEE
ENDGDASSSGDEDESNGGKGSKEKLPDYLRNLKENETPFKSRVQQSEINEKDQKLFQQLQ
TRIRKMENLKLEKSRIQAKQNQLTGLSEGQEKTLERNEQRIQALRKEIEDIEDRIYAKNA
QREQTKASAAASAAVAASVASRKKKQVNEALYGYGSDEDDFYDRTKSNQRKHLERKQQFG
VADNGSTSLATSSKPASAQQSSGSISSSVVLTADSIQAKIKALEIELRDVGEAYAATQAH
PAAAEEPKQEEEVDSLDAFMETTTRELHTTQLSSISARKQELERELQHLRQLLKVATPAL
AAFPTHTRAPSNERQKDPITNKSAALPHEETAPQPEKPDTTQTPKETRDDVSSSSTVVVS
PLKRPVVAEPTTSKPHEQEDRVDPVVYVAKPRGDKPEVKDNVAKPKRQRVLGPTLGPARG
SPTLGGSSGTGKPASSTRIAAGAVSSNATFEGGSTLEGGEQVWVPPANQTGDGRTRLNDK
YGY
Download sequence
Identical sequences K3WIY9
PYU1_T004931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]