SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004991 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004991
Domain Number 1 Region: 149-342,453-518,548-633
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.32e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000119
Further Details:      
 
Domain Number 2 Region: 320-453
Classification Level Classification E-value
Superfamily GAD domain-like 4.25e-28
Family GAD domain 0.0022
Further Details:      
 
Domain Number 3 Region: 27-134
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.09e-26
Family Anticodon-binding domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004991
Sequence length 666
Comment protein Name="PYU1_T004991" Note="Similar to aspS: Aspartyl-tRNA synthetase (Opitutus terrae (strain DSM 11246 / PB90-1))" AED:0.0251393127572366 QI:0|0|0|0.5|1|1|2|0|666
Sequence
MLRRLQRVQCSSNALLAGGSRAISSAFRTHTCGDLCADHAQGGERVRLSGWVDAIRPFGP
ISFISLRDRHGITQLVLEKNLLESADAVISKIRPESVIRVEGVVRARPDNMRNDNLATGA
IEVVVDDITELNSCATLPLQVASGSEIASEETRLRHRYLDLRRPTLQQNLLLRSQISLAT
RNFLCSEGFLEIETPTLFKSTPEGAREFLVPTRTKGQFYALTQSPQQYKQLLMVGGLDRY
FQLARCYRDEGGRADRQPEFTQIDLEMSFIKREDIMDVIERLVKEIWKSAGKELPAKPFT
RMNFQEAMHRFGVDKPDTRYGLELQDVSDLLQGTTFQPFQQVLEKNGRTKTTPSSKGVVR
AINAKGLASQGFSRKDMDELERTAKRLSKNGVFVVKVEANTTWKSSFAKKLTEAEIEQLN
ARLDAEDGDVLLFAAGEYSSVTALLGRMRTHSSQLLYAKGMLQNELDPANFHHLWVLNFP
MFERSEDEDPDQVHEGGKAVLSATHHPFTAPTDEDAVILDEILKSLDDGKKSLLEDPETV
EELLNLTAQHYDIVCNGWELGGGSIRIHQGKLQQAVFEEVLELPPLQRQSFEHLLQALSH
GAPPHGGIALGLDRLVAILCGAPSLRDVIAFPKSSTGNELMTNAPGPVLTEQLEEYHIQL
LQKNEG
Download sequence
Identical sequences K3WJ49
PYU1_T004991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]