SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005058 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005058
Domain Number 1 Region: 30-315
Classification Level Classification E-value
Superfamily Glycosyl hydrolases family 6, cellulases 6.41e-54
Family Glycosyl hydrolases family 6, cellulases 0.0000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005058
Sequence length 504
Comment protein Name="PYU1_T005058" Note="candidate cellulase; C-terminal membrane anchor" AED:0.291631776607788 QI:0|-1|0|1|-1|1|1|0|504
Sequence
MRRLTLSITALVLTAAANAEQLCSLPPITYAAAKAAHPEAAFALSELETRGIATWYSDRE
ENGDYVTTAKQLVALCPDDSRLSVVIYGLPNKDCDAGYSTIGSRNKSPYDYEQFVSTLAQ
IIGQRKVLYVLEPDAVGLLVGSTCAVQSGYKDNLKTAIRILSSSNANADIYLDVGYWTLA
ASDSRQRVADVVRELAAAGRVKGIALNTSNYRSNGELAHLCSSFQSVMGYNGMNCIIDTS
RNFHGSSSSEWCNLKSAGIGKPPTRDTGYPNIDYFVWVKPPGDSDGTCSDGASHTWEALP
GPGAGMFFEEGFRLLWNQGSLVQELNLPVIDSTYRSYSVATATPTSSPTPNPTPAPTEMT
PSPELLAVQALMEAMIKAQQQQQQQFNSGSGSSSDVVSSEAGSLPAGSNSSALASDPDAG
DVSEDEKEAEITTPSPFPSDSVKERGITTRANGGPSDAKVGVIITLFVAGIATVVGVMLF
VRLKQKQLQDSKSPNLSYLPATPN
Download sequence
Identical sequences K3WJB6
PYU1_T005058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]