SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005070 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005070
Domain Number 1 Region: 41-324
Classification Level Classification E-value
Superfamily Glycosyl hydrolases family 6, cellulases 2.22e-52
Family Glycosyl hydrolases family 6, cellulases 0.0000638
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005070
Sequence length 639
Comment protein Name="PYU1_T005070" Note="candidate cellulase; C-terminal membrane anchor" AED:0.272720743433396 QI:0|-1|0|1|-1|1|1|0|639
Sequence
MLSSFCHALLASAALIAASCVAQDAAAQEAPLCSLPSVSYANAKQNYPNSAFAISELEKY
TIATWYSDRNDYYMETATQLVTTCSESTRLSLVVYGLPNKDCEAGSSQTGSIVQNSDAYT
QFLSTLIGIINDRKVLYVLEPDAIGLLAKEGGCGAHAKYQENLQIAIAMLSANPNAEIYL
DVGYWTLQYPESAARVSQIVKDLAVFGRVKGITLNASNYRSNAEISQLCSSFQQTIGSDE
YRCIVDTSRNFKAPTTTEWCNSRSAGIGHPPTSDTRFSNLDYFMWIKPPGESDGKCDTES
HTADALPGPAPGQFFDESFQLLWNQGYFVNELGMRTIGGDQTPIHPTKTPVSEVPDSIAE
LPTLSSTMTPSISVALQNKPQEEISDSLIDAPVPDELLSPIPVDPSIKTTVDEMLPRDPD
SSTVTIESSVDVVAVTPCPSRPSAPFDDEILESLRLSHEQVAGFVKSNEVEFAPTELLSF
DNEEKLYEDDVESIAAPLSDPLAGQDETGFVENGSSSMDALDLINFVKRLDAPRGSSSGS
SDGNEVKALSAERLPPSLGSSNALGGQEFEASTSSGTKGGGSRTEILASIGVLGVICILA
VAAAAIKMKRRRDALMEARLSTPDMSVTHITPASSVSIA
Download sequence
Identical sequences K3WJC8
PYU1_T005070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]