SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005072 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005072
Domain Number 1 Region: 44-315
Classification Level Classification E-value
Superfamily Glycosyl hydrolases family 6, cellulases 6.8e-55
Family Glycosyl hydrolases family 6, cellulases 0.0000385
Further Details:      
 
Weak hits

Sequence:  PYU1_T005072
Domain Number - Region: 489-551
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0275
Family Hairpin loop containing domain 0.04
Further Details:      
 
Domain Number - Region: 383-423
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0785
Family Pan module (APPLE domain) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005072
Sequence length 554
Comment protein Name="PYU1_T005072" Note="candidate b-glycosidase distantly related to fungal cellulases; C-terminal CBM1 module" AED:0.197253413872325 QI:0|0|0|0.5|0|0.5|2|0|554
Sequence
MFGSLRRILAVIAIGVAYIASSNVRADELCSITPSTYATTKDAYPTMRSALSEMEKHSIA
TWYTDRGGDYATTARALVASCPESSRLSVVVYGLPNKDCAAGYSSGGSVKNAADYERFVT
TLTSIVGNRKILYVLEPDAIGLLSGGGCGEQAGYRENLKTAIRVLSSNPNAEIYLDVGYW
TLQSTAGAVAGVVKTLVGAGRVKGIALNTSNYRSNAEISSLCWNFQSAMGSNDYHCIVDT
SRNFVASSSSEWCNVKTAGIGAPPTSNTGYWNLDYFMWIKVPGESDGKCNDGTHNSDAMV
GPDAGAFFAEHFKMMWNQGYFVNKLGFSKIGAADSGGSSPCAASDYCQPWNPGFYQCRAE
PLRCGTQQVGVDFYGDDLTTQYGLFPEQCCDKCADTEGCKAYTFVNYNSDGKTACYLKKG
TGAKRYVEGVVSAEVIIPKIACSTPLGASCGNSQGTQCCPTGSYCQPWNSGYYQCIQKPA
KCSLQLTNTDFYGNDMGTAYGLSPAACCDKCTQTTGCKAYTFVNSNSDGKTVCYLKSSTV
GKRTSVGMISGVVS
Download sequence
Identical sequences K3WJD0
PYU1_T005072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]