SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005078 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005078
Domain Number 1 Region: 260-322,352-393,492-665,698-729
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.1e-61
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00043
Further Details:      
 
Domain Number 2 Region: 76-131
Classification Level Classification E-value
Superfamily RING/U-box 0.000000129
Family Zf-UBP 0.0091
Further Details:      
 
Domain Number 3 Region: 419-469
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000565
Family Ubiquitin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005078
Sequence length 734
Comment protein Name="PYU1_T005078" Note="Similar to Usp16: Ubiquitin carboxyl-terminal hydrolase 16 (Mus musculus)" AED:0.279767460165746 QI:0|0.2|0.16|0.5|1|1|6|55|734
Sequence
MTAKNCRHVSQALRMAEFRRALKAHDALACQLCVVPSVKQNSRGKANGSRTGSKSPKTPP
PPDEDSATLCQGWTRSAAWEDLCICVTCGFIGCLSANHFTQHFQLNPKHFVGFHVGAKTF
WCCPCKQEISDGKAKVEDARRECADTFDDISAKQQRKIKNRVVIATPTAPANGDNATGGE
DANGVNNAVAKTGSADSSANGELDQTASAAPENDSPSSEQSRKSKRGKERKEPKKAALAK
IADEPRDRSKSAPTPSVSSVLGFTNLGNTCYFNAAMQALLTAAHYFPEHVHIDDVLESSN
IPILMTFCMLHETIKKKVRRKSMSAVPDAESSIGTKQKAKKRDASSKSSDAVLTVAPLLK
EMRKKFSQFRGNDQQDAHELFTSFLWGIDEETDPPLSAESGMRSNKENTGNADQVAEVED
TGDQETKQIFVKTETGNTISMHVPMNATVKEVEHLLAKKLNLDEDDMMLNAGPRQSTRQS
SKEPAKSYSKLNFTRRLFGGILTTVVTCLACGNESRIEEDAFHLSVPVLSTTSRHSPTTI
DCLKSFMSETKLLVDAKNGYDCEKCSRTKSSKANVTDVILRDAKMNLVVTQLPRVLVIHI
KRLGRQKKITQHIQFDSFMEMAPYIDKSSLAGGKTPTCYELIAVVVHMGNKRSGHYVAYV
SRSRKRDAAPIKVNHAQELDSDDEFDPRAEIHTSENPSRSWYYISDTTVKPVAFEQVLQC
EAYMLFYRQLPENK
Download sequence
Identical sequences K3WJD6
PYU1_T005078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]