SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005086 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005086
Domain Number 1 Region: 32-299,398-480
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.24e-77
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000393
Further Details:      
 
Domain Number 2 Region: 500-643
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 7.98e-47
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0000843
Further Details:      
 
Domain Number 3 Region: 276-394
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.26e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000928
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005086
Sequence length 643
Comment protein Name="PYU1_T005086" Note="Similar to SDH1-1: Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial (Arabidopsis thaliana)" AED:0.00539889366344781 QI:0|1|0|1|1|1|2|0|643
Sequence
MLRASQMLSRAGRVPHARSFAVLSAQKPAGSANTSLTSKYTIIDHEYDAVVVGAGGAGLR
AAMGCAEAGLKTACISKLFPTRSHTVAAQGGINAALGNMSVDDWRWHMYDTVKGSDWLGD
QDAIHYMCREAPQAVRELESFGLPFSRTEEGKIYQRAFGGQSLEFGKGGQAHRCACAADR
TGHAMLHTLYGRSLAFDTSYFIEYFALDLIMNDDGDCVGVIAINMEDGTFHRFHTNNTVL
ATGGYGRAYFSCTSAHTCTGDGTGMALRAGIPLQDPEFVQFHPTGIYGAGCLITEGSRGE
GGILRNSEGERFMERYAPTAKDLASRDVVSRAMTMEIREGRGVGKHKDHIYLHLDHLPAE
LLAERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHLGEVVVPDVAGGMPGSV
DKMHPDRVVKGLFAAGEAACASVHGANRLGANSLLDLVVFGRACALRIAEITKPGEKKRP
MPSDGGLSSIAEVDKLRYADGHIPTAELRLEMQKTMQLDAAVYRTQSSLAAGKEKIDQVV
PKFKDIKVTDRSLIWNTDLIETFELKNLLACASSTMHAAEARKESRGAHAREDFTERNDE
EWMKHTLAYHGEDGKTHIRYREVHSETLDENECKHVPPFARVY
Download sequence
Identical sequences K3WJE4
PYU1_T005086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]