SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005134 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005134
Domain Number 1 Region: 432-539
Classification Level Classification E-value
Superfamily DUSP-like 0.000000000235
Family DUSP, domain in ubiquitin-specific proteases 0.0049
Further Details:      
 
Domain Number 2 Region: 310-409
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000861
Family PDZ domain 0.022
Further Details:      
 
Weak hits

Sequence:  PYU1_T005134
Domain Number - Region: 42-140
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00423
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005134
Sequence length 581
Comment protein Name="PYU1_T005134" Note="Protein of unknown function" AED:0.068129087566388 QI:0|1|0.5|1|1|1|2|131|581
Sequence
MTTPPSAATAPLSSIALDSPTPSAPFSSPSAAANPKTMLAGEEFADVHVSWELVRVTVPP
GPLGILLDASVASQAVLEGFAAIDADNKRGAVETHGGILPGSVLVSVNQYDFVESNMTFS
EIGQVLRETSHLEREIVFKVPMPESTREEEDAVTPPKSEDEGVSVTATDGDEDGGAWSET
ELAKELALVSPASVELLADALSQTSVDEQRLESPPDSSYDHISDSDLPPKITVSPPSSTT
SSTASVTRKGWSLAGFSLPTMPSKLSMPSLPKNLPHLPNLPNIPNLVGITSPFNKGNAHS
PSSHKEFPIDREPTEPEEDKFVTVEAPAGPLGLNLDGGILDHAVVVGFVPLPDGSVGALE
SHGGIRLGSVLVTINEEDVSSATLDEIRVKLGELSGTTRTLVFRLPRARLAKTASSVSTR
TLPVQLQEDLDKRRKMELALVVKYDKATIGRKECWFVIDANWMNNWVNFAARGGPLPGPI
TNEVLLEPNWKERLEGLAPGRADTPRKGLTAQKDYRCVTPMVFCLFVELHGMGEAPLLPR
FMIDIESEHVGNKEVAVILQEPRLKAAILANELRDKCVASR
Download sequence
Identical sequences K3WJJ2
PYU1_T005134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]