SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005193 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005193
Domain Number 1 Region: 20-69
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00000405
Family Regulator of chromosome condensation RCC1 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005193
Sequence length 186
Comment protein Name="PYU1_T005193" Note="Protein of unknown function" AED:0.340086850742182 QI:0|0.2|0.33|1|0|0.16|6|0|186
Sequence
MGLNRLRIDDNKDKITYNILFSWGRGDCGALGHGDAKTSSLPRSIDFFRSMRVLQRRRVE
FACGLGDVVHTGSSRAASCGCGGTVFTEALKLPSQIYRPSIDRTSLVHLEELLEHKSLTS
DSFRILYRCGPCKIDALCIACAHRCHIQHCLELTWTISNALSRECDCFYSGKCTFDNDGG
RQEDSD
Download sequence
Identical sequences K3WJQ1
PYU1_T005193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]