SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005243 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005243
Domain Number 1 Region: 402-539
Classification Level Classification E-value
Superfamily SAICAR synthase-like 7.19e-35
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00091
Further Details:      
 
Domain Number 2 Region: 578-747
Classification Level Classification E-value
Superfamily SAICAR synthase-like 6.02e-25
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.006
Further Details:      
 
Domain Number 3 Region: 59-256
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000888
Family Rhodopsin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005243
Sequence length 783
Comment protein Name="PYU1_T005243" Note="Similar to PIP5K6: Phosphatidylinositol-4-phosphate 5-kinase 6 (Arabidopsis thaliana)" AED:0.0510204081632653 QI:0|-1|0|1|-1|1|1|0|783
Sequence
MAAHVCTPAASSNSAAAISSIHGDADTTEGYFGRRLGAMSSNGTALAYLEPEFSGVETVK
LVASLVSFLGCVFIITTYFFFPPLRQHHSTFIVWIALMGLFFHGTVIVQAQVRYATCCTT
ASIIQLSLLSQELYLFVLACNFYFTTKYPFRKTKWFSSVYHCAVWVVSGVTAYMAASYGT
GSISSYGYCWYSFRGDNAESLLLKTFFLPVCAGYCISLTLYILATKRVRLSAGGPLDGGA
QTNLDSMRSFLFVSFAYWWLVSIPYVLRHRGVVEVNSTPDKSLRFIGRILLALKGTLVAI
TWARATRMNHAYRLWKQGNWDDYLKVYEATWVLRHEILYFATQGIQKSAELTGGRTEAEE
VEAQAESIFSFAQMAGVYPWQLRLGVLSEQPNVISFELDGLSNDQTVTFRDFEPDAFREI
RQLSGISTETYIQSFAGRTRERFSMGKSGSFLYYTGDQFFILKTCTPGEQRYLLQILPQY
TDHLKKNPNSYLCRYVGCHELVMAHQSVHFIVLTNILNNSTVNVDEFYDLKGSWVGRYQL
LARDGTQRVCKFCGRDFIVGMSKEVCEQNPNYGMGHAEFIVGKDLNWSYRKLGLPEDVAD
RLGAQLYADSEFLQRMNSMDYSLVIGLNRRHIYASSSSSTATSGMRTMRLDGSSSGRSTK
ADKGSSRLDESSAYLQALSPHSSRAGNELLPTGACVVNMGIIDILTPWSLKKSFENWIRV
RLQCQDPTGVSCIRPALYADRFRRNVVDTVIFGNPGHCSRSSDQRKDKEFIMVDFSGAIT
LQA
Download sequence
Identical sequences K3WJV1
PYU1_T005243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]