SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005260 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005260
Domain Number 1 Region: 1038-1058,1098-1350
Classification Level Classification E-value
Superfamily HAD-like 2.81e-50
Family Meta-cation ATPase, catalytic domain P 0.00021
Further Details:      
 
Domain Number 2 Region: 583-655
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 1.44e-21
Family HMA, heavy metal-associated domain 0.00054
Further Details:      
 
Domain Number 3 Region: 841-926
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.01e-19
Family Calcium ATPase, transduction domain A 0.0055
Further Details:      
 
Domain Number 4 Region: 782-823,927-1034,1294-1328
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000000641
Family Calcium ATPase, transmembrane domain M 0.016
Further Details:      
 
Domain Number 5 Region: 309-377
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000000017
Family HMA, heavy metal-associated domain 0.0018
Further Details:      
 
Domain Number 6 Region: 467-536
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00000000000288
Family HMA, heavy metal-associated domain 0.0017
Further Details:      
 
Domain Number 7 Region: 232-296
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00000000000458
Family HMA, heavy metal-associated domain 0.0019
Further Details:      
 
Domain Number 8 Region: 387-456
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00000000000969
Family HMA, heavy metal-associated domain 0.0029
Further Details:      
 
Domain Number 9 Region: 142-207
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000223
Family HMA, heavy metal-associated domain 0.0055
Further Details:      
 
Weak hits

Sequence:  PYU1_T005260
Domain Number - Region: 67-121
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00785
Family HMA, heavy metal-associated domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005260
Sequence length 1391
Comment protein Name="PYU1_T005260" Note="Similar to HMA5: Putative copper-transporting ATPase 3 (Arabidopsis thaliana)" AED:0.0247844827586207 QI:0|-1|0|1|-1|1|1|0|1391
Sequence
MGEKTAARSLTRGTSPDADADARRERELLPLLAAKGPSFKDGVCVSEAEDVPSLTSSQRK
VDADNVVFLIVPSLNDAATATLVVNGLQAAPGVLRVQLDLHEKLLRIETASRVEEAVEAE
LAEVVHRVTPDKLVAYPVWQHRDRIVRLHIHGMRCMTNCGTQVIRALEKIPSVLHIHVDS
KSKTAEVALGKGSTATEVDLIKYIRAVNPRFDAEIAKDNKTRERTNSMPGAVLLNIEGMS
CAKNCATKIQNALCEADGVIDATVDFSNKRATVILKPESTLNEDDLIAIVEGAGTKFNAS
VYQPFTEGASRVVHLTINGMSCAANCARKVEEALNNVNGVISAKVDFTSKLATVFLEPGS
RLQGADLIAIVQSAGAKFSASVSAPAPGPRTVRLTVDGMSCAKNCARKVQTALTETPGVE
SALVDFPLKRATVVVASGSSLTDDDLVRVVRSAGAKFNASLYAESAYSPPRTVVLDVSGM
SCAKNCARKIQTALSDADGVISATVNFSAKRATVQVDSSSALQDTDLVDVVRSVGAKFDA
AVVYEGHRIAEKSVSGSTLSNSHASTAKSDDVVVPINDAANSSDVGEIVLLIGGMTCNSC
SNSVEGALKQTPGVVSAVVSFATEKATVRFDKDVVGIRTLVETVEDIGYDATYVSGQEAQ
KALGDQRAKEVMRYRNDFLVAVVFTFPILVIMMVLGNIPPIDDLLMTSVFRGVTWMALLG
AVLATPVQFYSARRFHLDAWKGLKNRMLGMSFLVSMGSNASYFYGLFSLCRGAYLNESSV
SSPDMFMTASMLIAFVLLGKYLEAIAKGKTSEALSKLMDLQVKSATLLVMSKDGSKVLDE
KTVLIEMVQRGDILKVVRGCSVPADGVVVYGEGRLNEAMLTGESKAIKKGLGDKVLGATV
NVEGLFHMKVTGVGNDTALSQIIRLVEDAQTSKAPIQAYADYIASIFVPAVLVLSSLTFL
VWYVLCVSEIVPRDWIPATDGSFVFAFNFGIATLVVACPCALGLATPTAVMVGTGVGAEH
GVLIKGGEPLEAAHSIDTILFDKTGTLTVGEPVVTDVVILSKKLSAEELIVMAGCAELGS
EHPLSKAIIDYAKIISKTLEQPSSFSGVSGRGISCSVGSHNVVIGNKEWMVDNDMQRMDS
IVLFQATLTFQSAGKTSIYMGVDGELSAVFGVADAPRPEAIRTIKKLTDMGLDVWMVTGD
NAKTAITIADQLGIKRRNVMAEVVPSEKSSKVKKLQNSGRVVAMVGDGINDSPALAQADL
GIAIGAGTEIAVETAGMVLMKSNLVDVITALDLSRTIFNRIRLNYVWALGYNCLLIPLAA
GLLFPFGFRIPPMFAGGAMAISSVSVVTSSLLLRYYAPPAIPPAVGGNENKSLLFKKPSV
TTPLLASSSLA
Download sequence
Identical sequences K3WJW8
PYU1_T005260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]