SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005268 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005268
Domain Number 1 Region: 107-178
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000351
Family Homeodomain 0.0012
Further Details:      
 
Domain Number 2 Region: 303-369
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000334
Family Homeodomain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005268
Sequence length 647
Comment protein Name="PYU1_T005268" Note="Similar to BLH8: BEL1-like homeodomain protein 8 (Arabidopsis thaliana)" AED:0.0984843269539677 QI:0|0|0|1|1|1|4|0|647
Sequence
MTAEPSAADVQYSPPPPFRMPPMGRAPVKKKSKRDEQENRPQQQQVDDDDENDEEDEEDD
DDDDSDVKTKGKAKKSKSNATSHASASGANGVEDDAKAAEGDDKNVSKKSRRELPPHTVA
ILKGWMLSPEHVKHPYPTDEDKQMLLKKTGINMKQLTNWFTNARKRIWKPMMRREHSRQL
QSAMEYEKARPREAFSAVPVAPQQFQEGEYSARPVVRHSFDAGSLGPSHHQQPPFDPYAR
GDGRDAAAYPHGHPPPSSFPPRVGRSMSEALPGTSHEMDDYIDAMRIRKRVHERSPDGVE
VDAMGPSEKRYRRSAIMSPRSLKVLQDWVVTHSHSEYPFPSDAEKLQLSRDTGLDVQQIE
MWFKNNRERIGAANFAIQNGAPGLSPSRRSLPGRSIPSRDNPMFPPPQYGERRSIPSSGN
PMFPPRPAAPMRSSIPGNGNPQFPPPPARRESAEGYYPHGPQYGNGQYPPPHAYGADQSR
PIRSMSINTGQQYMRPQPRPSPVNNTAPAGSGGLPSLANRSVIPRVSPGPTMGQPRDARS
HTLDMGLFTDARRRKMNFQDILASTSSSHPPAAPAHAPAAHPAGMPETSRHPNSVSNSTE
NVYSNAIPVYTGPKSFERSHIGQVPACGRCGARLGSCGCGDGERRIV
Download sequence
Identical sequences K3WJX6
PYU1_T005268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]