SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005316 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005316
Domain Number 1 Region: 93-166
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000103
Family Centromere-binding 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005316
Sequence length 198
Comment protein Name="PYU1_T005316" Note="Similar to cbh2: CENP-B homolog protein 2 (Schizosaccharomyces pombe)" AED:0.372125604983443 QI:0|-1|0|1|-1|1|1|0|198
Sequence
MPPKAKAKARPRVVYRLTKAQMAVPVRIHLTNKQKTFLRAHRRENPDLKLQELCDWAKET
FALPNAPAVSALSTVLKQPDITDKAAEQIKVNRKRETRVLEEELCAWIAQCEELGMPRLT
GSAIRNQAQTICRERLARDDISSEERAALSALRFSNGWLHGFQTRYRSAAHGDGGCSGNA
RTGQQRGRKPVTMLSVLN
Download sequence
Identical sequences K3WK24
PYU1_T005316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]