SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005328 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T005328
Domain Number - Region: 19-82
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.049
Family PLC-like (P variant) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005328
Sequence length 102
Comment protein Name="PYU1_T005328" Note="Similar to UPF0569 transmembrane protein (Homo sapiens)" AED:0.307289258745569 QI:0|0|0|0.25|1|1|4|0|102
Sequence
MATTTSLRGMQDRAARNRAHNSMVWRKLLFFTVLMVTLPLGTFFGLKRYIGPNNPNADSW
SGFAAVLMVNIVIGVYILSAWSESDEKEVAPPVGRWSKAKDE
Download sequence
Identical sequences K3WK36
PYU1_T005328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]