SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005343 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T005343
Domain Number - Region: 136-180
Classification Level Classification E-value
Superfamily Mss4-like 0.000994
Family SelR domain 0.01
Further Details:      
 
Domain Number - Region: 266-325
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.00676
Family Mannose 6-phosphate receptor domain 0.01
Further Details:      
 
Domain Number - Region: 52-81
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.0157
Family HSP33 redox switch-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005343
Sequence length 399
Comment protein Name="PYU1_T005343" Note="Similar to OS9: Protein OS-9 (Bos taurus)" AED:0.150760233918129 QI:0|0|0|0.5|1|1|4|0|399
Sequence
MSGMTARKALALLLFVGLCALPTAALSRPKKTLAVQPAASEKDGAVDHHHDDHEHEQHED
EEGNVVVRCRFCGATVAFKKDYIGLHDTSKAVASKRESILGDDGELHTFVNPSRVEMDLA
GFKKSYAMESEAYTSKATFFEDYNWRDIHCSSCKRHLGWKFHHDELQQCINAKAIEGITA
KTKSAAAPQQDTVDAAASEKERKVKIVQDVLEGDCIAATSGWWSYQVCYGKEVRQYHEEA
DGTRPSDWSMGVYVEDDKALDTPDLGTDVVQYFAGGQHCDENGELRNTKVTYTCCKTNPK
VLSIESVEEPSLCSYIINVCIPELCDGTGNDATADATLADTKKYTELCESELADSLTTER
DSDIKKKNVPPSFTTLRWSTVISEDSSELDWVRRLKFKA
Download sequence
Identical sequences K3WK51
PYU1_T005343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]