SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005385 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005385
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.24e-24
Family Ubiquitin-related 0.0000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005385
Sequence length 73
Comment protein Name="PYU1_T005385" Note="Similar to UBL5: Ubiquitin-like protein 5 (Arabidopsis thaliana)" AED:0.459354159354159 QI:0|-1|0|1|-1|1|1|0|73
Sequence
MIEVVLNDRLGKKIRVKCNEDDTVGDLKKLVAAQVGTRPEKIRIQKWYTIYKDHITLEDY
EIHDGMGLELYYT
Download sequence
Identical sequences A0A225W6I5 K3WK93
PYU1_T005385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]